Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RINL Peptide - N-terminal region

RINL Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ44131, FLJ45909

UniProt

Q6ZS11

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RINL Rabbit Polyclonal Antibody (orb586731) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IP, WB

NCBI Accession Number

NP_940847

Preservative

Lyophilized powder

AA Sequence

ETHRGWGREQTPQETEPEAAQRHDPAPRNPAPHGVSWVKGPLSPEVDHPG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Arginase 1 (ARG1) (1-145) Rabbit Polyclonal Antibody
AP23580PU-N 50 µL

Arginase 1 (ARG1) (1-145) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tmem126a (NM_025460) Mouse Recombinant Protein
TP501925 20 µg

Tmem126a (NM_025460) Mouse Recombinant Protein

Sign In for Pricing
View Details
LAMA3 (NM_000227) Human Over-expression Lysate
LC424855 20 µg

LAMA3 (NM_000227) Human Over-expression Lysate

Sign In for Pricing
View Details
Fluorescence Spectrophotometer BSFL-103
BSFL-103 1 Unit

Fluorescence Spectrophotometer BSFL-103

Sign In for Pricing
View Details
MAP1LC3B Antibody
KC-4517-01 50 μL

MAP1LC3B Antibody

Sign In for Pricing
View Details
MAP1LC3B Antibody
KC-4517-02 100 µL

MAP1LC3B Antibody

Sign In for Pricing
View Details