Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RINL Peptide - N-terminal region

RINL Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ44131, FLJ45909

UniProt

Q6ZS11

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RINL Rabbit Polyclonal Antibody (orb586731) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IP, WB

NCBI Accession Number

NP_940847

Preservative

Lyophilized powder

AA Sequence

ETHRGWGREQTPQETEPEAAQRHDPAPRNPAPHGVSWVKGPLSPEVDHPG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Peripherin Chicken Polyclonal Antibody
AP31818PU-N 200 µL

Peripherin Chicken Polyclonal Antibody

Sign In for Pricing
View Details
PCSK9 (214-228) Goat Polyclonal Antibody
AP22408PU-N 100 µg

PCSK9 (214-228) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Human ATP6V1G3 activation kit by CRISPRa
GA114984 1 Kit

Human ATP6V1G3 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant UBA3 Antibody
RC-5958-01 50 μL

Recombinant UBA3 Antibody

Sign In for Pricing
View Details
Recombinant UBA3 Antibody
RC-5958-02 100 µL

Recombinant UBA3 Antibody

Sign In for Pricing
View Details
Recombinant UBA3 Antibody
RC-5958-03 1 mL

Recombinant UBA3 Antibody

Sign In for Pricing
View Details