Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS4Y2 Peptide - C-terminal region

RPS4Y2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RPS4Y2P

UniProt

Q8TD47

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPS4Y2 Rabbit Polyclonal Antibody (orb586735) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001034656

Preservative

Lyophilized powder

AA Sequence

TGKITSFIKFDTGNVCMVIAGANLGRVGVITNRERHPGSCDVVHVKDANG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mini Sample Human CXCL1 (Growth Regulated Oncogene Alpha) ELISA Kit
E-MSEL-H0037-01 10x 96 Tests

Mini Sample Human CXCL1 (Growth Regulated Oncogene Alpha) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Human CXCL1 (Growth Regulated Oncogene Alpha) ELISA Kit
E-MSEL-H0037-02 5x 96 Tests

Mini Sample Human CXCL1 (Growth Regulated Oncogene Alpha) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Human CXCL1 (Growth Regulated Oncogene Alpha) ELISA Kit
E-MSEL-H0037-03 96 Tests

Mini Sample Human CXCL1 (Growth Regulated Oncogene Alpha) ELISA Kit

Sign In for Pricing
View Details
PELI3 Human Gene Knockout Kit (CRISPR)
KN418104 1 Kit

PELI3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Aprataxin (APTX) activation kit by CRISPRa
GA110301 1 Kit

Human Aprataxin (APTX) activation kit by CRISPRa

Sign In for Pricing
View Details
GST-Tag Monoclonal Antibody
E-AB-48005-01 25 µL

GST-Tag Monoclonal Antibody

Sign In for Pricing
View Details