Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS4Y2 Peptide - C-terminal region

RPS4Y2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RPS4Y2P

UniProt

Q8TD47

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPS4Y2 Rabbit Polyclonal Antibody (orb586735) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001034656

Preservative

Lyophilized powder

AA Sequence

TGKITSFIKFDTGNVCMVIAGANLGRVGVITNRERHPGSCDVVHVKDANG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Higenamine Hydrochloride
TRC-H325818-50MG 50 mg

Higenamine Hydrochloride

Sign In for Pricing
View Details
CD300LD Human Gene Knockout Kit (CRISPR)
KN425214 1 Kit

CD300LD Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Uncoated Human cTnT/TNNT2 (Troponin T Type 2, Cardiac) ELISA Kit
E-UNEL-H0047-01 5x 96 Tests

Uncoated Human cTnT/TNNT2 (Troponin T Type 2, Cardiac) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human cTnT/TNNT2 (Troponin T Type 2, Cardiac) ELISA Kit
E-UNEL-H0047-02 15x 96 Tests

Uncoated Human cTnT/TNNT2 (Troponin T Type 2, Cardiac) ELISA Kit

Sign In for Pricing
View Details
AMIGO1 (NM_020703) Human Over-expression Lysate
LY402810 100 µg

AMIGO1 (NM_020703) Human Over-expression Lysate

Sign In for Pricing
View Details
Beta III Tubulin Mouse monoclonal Antibody
HA600133F 100 µL

Beta III Tubulin Mouse monoclonal Antibody

Sign In for Pricing
View Details