RSPH9 Peptide - N-terminal region
RSPH9 Peptide - N-terminal region
Product Specifications
Product Name Alternative
C6orf206, CILD12, FLJ30845, MRPS18AL1
UniProt
Q9H1X1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RSPH9 Rabbit Polyclonal Antibody (orb326649) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001180270
Preservative
Lyophilized powder
AA Sequence
GLVADYYIAQGLSEDQLAPRKTLYSLNCTEWSLLPPATEEMVAQSSVVKG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GM-505-5 1 mL
Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to Biotin, 5nm
Sign In for Pricing
View Details 
![(-)-8,9-Dihydroxy-8,9-dihydrobenz[a]anthracene](https://cdn.genprice.uk/products/572/3456887377161/imageurl/trc-d452995-2.5mg.webp)
TRC-D452995-2.5MG 2.5 mg
(-)-8,9-Dihydroxy-8,9-dihydrobenz[a]anthracene
Sign In for Pricing
View Details 
LC424660 20 µg
Renin (REN) (NM_000537) Human Over-expression Lysate
Sign In for Pricing
View Details 
AP31430PU-N 50 µg
Macrophage Inflammatory Protein 3 alpha (CCL20) (33-44) Goat Polyclonal Antibody
Sign In for Pricing
View Details 