Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RSPH9 Peptide - N-terminal region

RSPH9 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C6orf206, CILD12, FLJ30845, MRPS18AL1

UniProt

Q9H1X1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RSPH9 Rabbit Polyclonal Antibody (orb326649) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001180270

Preservative

Lyophilized powder

AA Sequence

GLVADYYIAQGLSEDQLAPRKTLYSLNCTEWSLLPPATEEMVAQSSVVKG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Iproplatin
TRC-I740520-10MG 10 mg

Iproplatin

Sign In for Pricing
View Details
Vinylbenzyl Chloride, Mixture of 2, 3- and 4-isomers (Stabilized with TBC)
TRC-V757053-1G 1 g

Vinylbenzyl Chloride, Mixture of 2, 3- and 4-isomers (Stabilized with TBC)

Sign In for Pricing
View Details
ApoL1 Antibody
KC-25987-01 50 μL

ApoL1 Antibody

Sign In for Pricing
View Details
ApoL1 Antibody
KC-25987-02 100 µL

ApoL1 Antibody

Sign In for Pricing
View Details
ApoL1 Antibody
KC-25987-03 1 mL

ApoL1 Antibody

Sign In for Pricing
View Details
VAP1 (AOC3) Rabbit Polyclonal Antibody
TA369453 100 µL

VAP1 (AOC3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details