Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAMD3 Peptide - C-terminal region

SAMD3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ34563, MGC35163

UniProt

Q8N6K7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SAMD3 Rabbit Polyclonal Antibody (orb586737) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001017373

Preservative

Lyophilized powder

AA Sequence

ALVAAFHVFRIECPRRLSQTFNFLETLIFDMHSPYFPSLKEKENEVGFQH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Boc-pyrrolidine
TRC-B665850-25G 25 g

N-Boc-pyrrolidine

Sign In for Pricing
View Details
TIMP4 (NM_003256) Human Over-expression Lysate
LC401122 20 µg

TIMP4 (NM_003256) Human Over-expression Lysate

Sign In for Pricing
View Details
C1QA / Complement C1q A-Chain (C1QA/2783), CF405S conjugate, 0.1mg/mL
BNC042783-500 1x 500 µL

C1QA / Complement C1q A-Chain (C1QA/2783), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Phthalic Acid
TRC-P384480-10G 10 g

Phthalic Acid

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometrium
CS503208 5x 5 µm

Frozen Tissue Sections, Endometrium

Sign In for Pricing
View Details
3830406C13Rik (NM_178141) Mouse Tagged ORF Clone
MG200679 10 µg

3830406C13Rik (NM_178141) Mouse Tagged ORF Clone

Sign In for Pricing
View Details