Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAMD3 Peptide - C-terminal region

SAMD3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ34563, MGC35163

UniProt

Q8N6K7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SAMD3 Rabbit Polyclonal Antibody (orb586737) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001017373

Preservative

Lyophilized powder

AA Sequence

ALVAAFHVFRIECPRRLSQTFNFLETLIFDMHSPYFPSLKEKENEVGFQH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AUH (NM_001698) Human Over-expression Lysate
LY419798 100 µg

AUH (NM_001698) Human Over-expression Lysate

Sign In for Pricing
View Details
Sumo1 Antibody
8C0372-AAT 50 µg

Sumo1 Antibody

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB521592 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
2-Carboxycyclohexaneacetic Acid
TRC-C906120-250MG 250 mg

2-Carboxycyclohexaneacetic Acid

Sign In for Pricing
View Details
C5L2 (C5AR2) Rabbit Polyclonal Antibody
TA363651 100 µL

C5L2 (C5AR2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Protein Lysate, Stomach
CP565727 150 µg

Tissue Protein Lysate, Stomach

Sign In for Pricing
View Details