Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCAMP4 Peptide - C-terminal region

SCAMP4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ33847, FLJ90105, SCAMP-4

UniProt

Q969E2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SCAMP4 Rabbit Polyclonal Antibody (orb586738) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_524558

Preservative

Lyophilized powder

AA Sequence

RGAGGSFQKAQTEWNTGTWRNPPSREAQYNNFSGNSLPEYPTVPSYPGSG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRAP Antibody (N-term)
E45R08512G-4 50 µL

MRAP Antibody (N-term)

Sign In for Pricing
View Details
Gh1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6889906 1.0 µg DNA

Gh1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Human S1PR1 (Sphingosine 1-phosphate receptor 1) ELISA Kit
EH1597 96 Tests

Human S1PR1 (Sphingosine 1-phosphate receptor 1) ELISA Kit

Sign In for Pricing
View Details
Anti-ILKAP Antibody Picoband®, Dylight594 Conjugate
A08074-1-Dylight594 100 µg

Anti-ILKAP Antibody Picoband®, Dylight594 Conjugate

Sign In for Pricing
View Details
CD150 antibody (biotin)
MBS833549-01 0.1 mg

CD150 antibody (biotin)

Sign In for Pricing
View Details
CD150 antibody (biotin)
MBS833549-02 5x 0.1 mg

CD150 antibody (biotin)

Sign In for Pricing
View Details