Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPINK9 Peptide - middle region

SPINK9 Peptide - middle region

Product Specifications

Product Name Alternative

LEKTI2

UniProt

Q5DT21

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPINK9 Rabbit Polyclonal Antibody (orb586748) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001035523

Preservative

Lyophilized powder

AA Sequence

KKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFCSKVKKTDGTLKFVHFGK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPL42P2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV770843 1.0 µg DNA

MRPL42P2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Phospho-SHIP1 (Tyr1020) Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-3398R-BF680 100 µL

Phospho-SHIP1 (Tyr1020) Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Fiber Optic Cannulae with Ø2.5 mm Ceramic Ferrule, 200um Core, 0.39NA, 20/pkg
R-FOC-F200C-39NA 20/Pack

Fiber Optic Cannulae with Ø2.5 mm Ceramic Ferrule, 200um Core, 0.39NA, 20/pkg

Sign In for Pricing
View Details
Aacs Double Nickase Plasmid (m)
sc-429737-NIC 20 µg

Aacs Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Proteasome 19S S5A Rabbit Polyclonal Antibody (Biotin)
orb459493 100 µL

Proteasome 19S S5A Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
LMBRD2 Lentiviral Activation Particles (h2)
sc-413934-LAC-2 200 µL

LMBRD2 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details