Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPINK9 Peptide - middle region

SPINK9 Peptide - middle region

Product Specifications

Product Name Alternative

LEKTI2

UniProt

Q5DT21

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPINK9 Rabbit Polyclonal Antibody (orb586748) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001035523

Preservative

Lyophilized powder

AA Sequence

KKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFCSKVKKTDGTLKFVHFGK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GXYLT1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV655988 1.0 µg DNA

GXYLT1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Ska2 (H-2) Alexa Fluor® 680
sc-514495 AF680 200 µg/mL

Ska2 (H-2) Alexa Fluor® 680

Sign In for Pricing
View Details
CPEB3, Human (His, Strep)
HY-P703299-01 10 µg

CPEB3, Human (His, Strep)

Sign In for Pricing
View Details
CPEB3, Human (His, Strep)
HY-P703299-02 50 µg

CPEB3, Human (His, Strep)

Sign In for Pricing
View Details
Anti-Ebolavirus, GP (Clone EBOV-548) -Purified No Carrier Protein
12-8207-250 250 µg

Anti-Ebolavirus, GP (Clone EBOV-548) -Purified No Carrier Protein

Sign In for Pricing
View Details
CEBPB Antibody Blocking Peptide
orb1512786 500 µg

CEBPB Antibody Blocking Peptide

Sign In for Pricing
View Details