Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STK35 Peptide - C-terminal region

STK35 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CLIK1, STK35L1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STK35 Rabbit Polyclonal Antibody (orb586750) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_543026

Preservative

Lyophilized powder

AA Sequence

LENPKMELHIPQKRRTSMSEGIKQLLKDMLAANPQDRPDAFELETRMDQV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zebrafish TKT (Transketolase) ELISA Kit
EK247886 96 Well

Zebrafish TKT (Transketolase) ELISA Kit

Sign In for Pricing
View Details
Kbtbd11 (NM_029116) Mouse Recombinant Protein
PM44062M5 20 µg

Kbtbd11 (NM_029116) Mouse Recombinant Protein

Sign In for Pricing
View Details
Anti-LPIN2 Antibody
A05628 100 µL

Anti-LPIN2 Antibody

Sign In for Pricing
View Details
Bovine B-Cell Cll/Lymphoma 10 ELISA Kit
MBS027598-01 48 Well

Bovine B-Cell Cll/Lymphoma 10 ELISA Kit

Sign In for Pricing
View Details
Bovine B-Cell Cll/Lymphoma 10 ELISA Kit
MBS027598-02 96 Well

Bovine B-Cell Cll/Lymphoma 10 ELISA Kit

Sign In for Pricing
View Details
Bovine B-Cell Cll/Lymphoma 10 ELISA Kit
MBS027598-03 5x 96 Well

Bovine B-Cell Cll/Lymphoma 10 ELISA Kit

Sign In for Pricing
View Details