Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STK35 Peptide - C-terminal region

STK35 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CLIK1, STK35L1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STK35 Rabbit Polyclonal Antibody (orb586750) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_543026

Preservative

Lyophilized powder

AA Sequence

LENPKMELHIPQKRRTSMSEGIKQLLKDMLAANPQDRPDAFELETRMDQV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rab3A+Rab3B+Rab3C+Rab3D Rabbit Polyclonal Antibody (BF680)
orb2402736 100 µL

Rab3A+Rab3B+Rab3C+Rab3D Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
Mitochondrial Nucleoid-Associated Protein 1 (MTNAP1) Antibody
abx122697-01 100 µg

Mitochondrial Nucleoid-Associated Protein 1 (MTNAP1) Antibody

Sign In for Pricing
View Details
Mitochondrial Nucleoid-Associated Protein 1 (MTNAP1) Antibody
abx122697-02 1 mg

Mitochondrial Nucleoid-Associated Protein 1 (MTNAP1) Antibody

Sign In for Pricing
View Details
SYPL1 Rabbit Monoclonal Antibody [Clone ID: 23GB4675]
TA425256 100 µL

SYPL1 Rabbit Monoclonal Antibody [Clone ID: 23GB4675]

Sign In for Pricing
View Details
LOC100365935 3'UTR GFP Stable Cell Line
TU259696 1.0 mL

LOC100365935 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
N-Heptafluorobutyrylimidazole
GW9945-1g 1 g

N-Heptafluorobutyrylimidazole

Sign In for Pricing
View Details