Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SUCNR1 Peptide - middle region

SUCNR1 Peptide - middle region

Product Specifications

Product Name Alternative

GPR91

UniProt

Q9BXA5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SUCNR1 Rabbit Polyclonal Antibody (orb586752) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_149039

Preservative

Lyophilized powder

AA Sequence

INPVITDNGTTCNDFASSGDPNYNLIYSMCLTLLGFLIPLFVMCFFYYKI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,2-Butanediol
TRC-B806965-50G 50 g

1,2-Butanediol

Sign In for Pricing
View Details
N-Acetyl Sulfapyridine
TRC-A187910-25MG 25 mg

N-Acetyl Sulfapyridine

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS501367 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Zc3h14 Mouse Gene Knockout Kit (CRISPR)
KN519641 1 Kit

Zc3h14 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Polystyrene A Sulfonic Acid
HA2503150430.1G 1 g

Polystyrene A Sulfonic Acid

Sign In for Pricing
View Details
SPACA4 (NM_133498) Human Recombinant Protein
TP308285M 100 µg

SPACA4 (NM_133498) Human Recombinant Protein

Sign In for Pricing
View Details