Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SUCNR1 Peptide - middle region

SUCNR1 Peptide - middle region

Product Specifications

Product Name Alternative

GPR91

UniProt

Q9BXA5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SUCNR1 Rabbit Polyclonal Antibody (orb586752) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_149039

Preservative

Lyophilized powder

AA Sequence

INPVITDNGTTCNDFASSGDPNYNLIYSMCLTLLGFLIPLFVMCFFYYKI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP2B2 (NM_001001331) Human Over-expression Lysate
LC424326 20 µg

ATP2B2 (NM_001001331) Human Over-expression Lysate

Sign In for Pricing
View Details
CD9 (TSPAN29) (Motility-Related Protein-1) (CD9/2343), CF740 conjugate, 0.1mg/mL
BNC742343-100 1x 100 µL

CD9 (TSPAN29) (Motility-Related Protein-1) (CD9/2343), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS804319 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
PDE4 (PDE4B) (NM_001037341) Human Over-expression Lysate
LY421908 100 µg

PDE4 (PDE4B) (NM_001037341) Human Over-expression Lysate

Sign In for Pricing
View Details
Osteopontin Human (OPN) ELISA Kit
K021-H1 1 Plate

Osteopontin Human (OPN) ELISA Kit

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD90 Antibody[M5/49.4.1]
E-AB-F1283M1-01 50 Tests

Elab Fluor® 700 Anti-Mouse CD90 Antibody[M5/49.4.1]

Sign In for Pricing
View Details