Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

THOP1 Peptide - C-terminal region

THOP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

EP24.15, MEPD_HUMAN, MP78, TOP

UniProt

P52888

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with THOP1 Rabbit Polyclonal Antibody (orb586757) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003240

Preservative

Lyophilized powder

AA Sequence

MDYRSCILRPGGSEDASAMLRRFLGRDPKQDAFLLSKGLQVGGCEPEPQV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTF2 Antibody
8C10022-AAT 50 µg

TTF2 Antibody

Sign In for Pricing
View Details
MAP126 (SPAG5) Mouse Monoclonal Antibody [Clone ID: OTI5H5]
CF810456 100 µg

MAP126 (SPAG5) Mouse Monoclonal Antibody [Clone ID: OTI5H5]

Sign In for Pricing
View Details
ZFYVE1 Mouse Monoclonal Antibody [Clone ID: OTI1A2]
CF810160 100 µg

ZFYVE1 Mouse Monoclonal Antibody [Clone ID: OTI1A2]

Sign In for Pricing
View Details
CD68 Recombinant Rabbit Monoclonal Antibody [PSH06-65]
HA722737 100 µL

CD68 Recombinant Rabbit Monoclonal Antibody [PSH06-65]

Sign In for Pricing
View Details
BIBU 1361 Dihydrochloride
TRC-B377008-2.5MG 2.5 mg

BIBU 1361 Dihydrochloride

Sign In for Pricing
View Details
5-Chloro-Vortioxetine Hydrobromide
TRC-C424115-25MG 25 mg

5-Chloro-Vortioxetine Hydrobromide

Sign In for Pricing
View Details