Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC35G2 Peptide - C-terminal region

SLC35G2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp564K2464, MGC3295

UniProt

Q8TBE7

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC35G2 Rabbit Polyclonal Antibody (orb586758) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079522

Preservative

Lyophilized powder

AA Sequence

LQLLVLHIFPSIYDVFGGVIIMISVFVLAGYKLYWRNLRKQDYQEILDSP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Transcription factor Sp1 (SP1) ELISA Kit
RK13834 96 Tests

Mouse Transcription factor Sp1 (SP1) ELISA Kit

Sign In for Pricing
View Details
Frozen Tissue Sections, Metastasis, unknown source
CS514912 5x 5 µm

Frozen Tissue Sections, Metastasis, unknown source

Sign In for Pricing
View Details
Ganglioside GD1b Antibody
B2011060 100 µg

Ganglioside GD1b Antibody

Sign In for Pricing
View Details
Eph receptor B4 (EPHB4) (NM_004444) Human Untagged Clone
SC323544 10 µg

Eph receptor B4 (EPHB4) (NM_004444) Human Untagged Clone

Sign In for Pricing
View Details
Lentiviral human DNAJC10 sgRNA gene knockout kit - Lentiviral human DNAJC10 sgRNA gene knockout kit (25)
GTR15387129 1 Vial

Lentiviral human DNAJC10 sgRNA gene knockout kit - Lentiviral human DNAJC10 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Recombinant Mouse ST6GALNAC2 protein (C-6His)
CD00213-01 10 µg

Recombinant Mouse ST6GALNAC2 protein (C-6His)

Sign In for Pricing
View Details