Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC35G2 Peptide - C-terminal region

SLC35G2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp564K2464, MGC3295

UniProt

Q8TBE7

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC35G2 Rabbit Polyclonal Antibody (orb586758) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079522

Preservative

Lyophilized powder

AA Sequence

LQLLVLHIFPSIYDVFGGVIIMISVFVLAGYKLYWRNLRKQDYQEILDSP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal STMN1 / Stathmin / LAG Antibody (phospho-Ser16)
APR13578G 0.05ml

Polyclonal STMN1 / Stathmin / LAG Antibody (phospho-Ser16)

Sign In for Pricing
View Details
TRPM4 antibody - N-terminal region
MBS3202508-01 0.1 mL

TRPM4 antibody - N-terminal region

Sign In for Pricing
View Details
TRPM4 antibody - N-terminal region
MBS3202508-02 5x 0.1 mL

TRPM4 antibody - N-terminal region

Sign In for Pricing
View Details
(S) -2-Amino-3-mesitylpropanoic acid hydrochloride
OR1068913-01 50 mg

(S) -2-Amino-3-mesitylpropanoic acid hydrochloride

Sign In for Pricing
View Details
(S) -2-Amino-3-mesitylpropanoic acid hydrochloride
OR1068913-02 100 mg

(S) -2-Amino-3-mesitylpropanoic acid hydrochloride

Sign In for Pricing
View Details
(S) -2-Amino-3-mesitylpropanoic acid hydrochloride
OR1068913-03 250 mg

(S) -2-Amino-3-mesitylpropanoic acid hydrochloride

Sign In for Pricing
View Details