Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UQCRQ Peptide - middle region

UQCRQ Peptide - middle region

Product Specifications

Product Name Alternative

QCR8, QP-C, QPC, UQCR7

UniProt

O14949

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UQCRQ Rabbit Polyclonal Antibody (orb586759) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055217

Preservative

Lyophilized powder

AA Sequence

KGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAYENDK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC18 / Mucin 18 / CD146 (OJ79c), Biotin conjugate, 0.1mg/mL
BNCB0676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
delta 1 Catenin/CAS Rabbit Polyclonal Antibody
ER1901-92 100 µL

delta 1 Catenin/CAS Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human CMTM4 activation kit by CRISPRa
GA115550 1 Kit

Human CMTM4 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Small intestine
CS642359 5x 5 µm

Frozen Tissue Sections, Small intestine

Sign In for Pricing
View Details
2-Fluoro-5’-adenylic Acid
TRC-F621545-10MG 10 mg

2-Fluoro-5’-adenylic Acid

Sign In for Pricing
View Details
Cell Meter™ RX660 fixable viability dye
22530-AAT 200 Tests

Cell Meter™ RX660 fixable viability dye

Sign In for Pricing
View Details