Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACTR6 Peptide - C-terminal region

ACTR6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ARP6, CDA12, FLJ13433, HSPC281, MSTP136, hARP6, hARPX

UniProt

Q9GZN1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACTR6 Rabbit Polyclonal Antibody (orb586761) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071941

Preservative

Lyophilized powder

AA Sequence

TIKKGFCKPREEMVLSGKYKSGEQILRLANERFAVPEILFNPSDIGIQEM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TOP1 Antibody
KC-1608-01 50 μL

TOP1 Antibody

Sign In for Pricing
View Details
TOP1 Antibody
KC-1608-02 100 µL

TOP1 Antibody

Sign In for Pricing
View Details
TOP1 Antibody
KC-1608-03 1 mL

TOP1 Antibody

Sign In for Pricing
View Details
0.5 mL thin-walled polypropylene tubes  for Qubit assay
83509ES03 500 Tubes/Box

0.5 mL thin-walled polypropylene tubes for Qubit assay

Sign In for Pricing
View Details
Human CYB5R2 activation kit by CRISPRa
GA109948 1 Kit

Human CYB5R2 activation kit by CRISPRa

Sign In for Pricing
View Details
5,8-Tridecanedione
TRC-T819265-100MG 100 mg

5,8-Tridecanedione

Sign In for Pricing
View Details