Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACTR6 Peptide - C-terminal region

ACTR6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ARP6, CDA12, FLJ13433, HSPC281, MSTP136, hARP6, hARPX

UniProt

Q9GZN1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACTR6 Rabbit Polyclonal Antibody (orb586761) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071941

Preservative

Lyophilized powder

AA Sequence

TIKKGFCKPREEMVLSGKYKSGEQILRLANERFAVPEILFNPSDIGIQEM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF447 (ZSCAN18) (NM_001145542) Human Over-expression Lysate
LY428933 100 µg

ZNF447 (ZSCAN18) (NM_001145542) Human Over-expression Lysate

Sign In for Pricing
View Details
Ldah Mouse Gene Knockout Kit (CRISPR)
KN500028 1 Kit

Ldah Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ezrin (EZR) Rabbit Polyclonal Antibody
AP02712PU-N 100 µL

Ezrin (EZR) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IL5RA (NM_175725) Human Recombinant Protein
TP305386 20 µg

IL5RA (NM_175725) Human Recombinant Protein

Sign In for Pricing
View Details
NKX2.8 (NKX28/3233R), CF568 conjugate, 0.1mg/mL
BNC683233-500 1x 500 µL

NKX2.8 (NKX28/3233R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAP3K11 Polyclonal Antibody
E-AB-16612-01 20 µL

MAP3K11 Polyclonal Antibody

Sign In for Pricing
View Details