Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANKRD33 Peptide - C-terminal region

ANKRD33 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C12orf7, DKFZp686O1689

UniProt

Q7Z3H0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ANKRD33 Rabbit Polyclonal Antibody (orb586766) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_872414

Preservative

Lyophilized powder

AA Sequence

WVFVPYQSPQGILSKCLQWLQPRDSTSPRPQVPKILLSKASSSSHQCQPK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Flumatinib (mesylate)
HY-13905-01 5 mg

Flumatinib (mesylate)

Sign In for Pricing
View Details
Flumatinib (mesylate)
HY-13905-02 10 mg

Flumatinib (mesylate)

Sign In for Pricing
View Details
Flumatinib (mesylate)
HY-13905-03 10 mM - 1 mL

Flumatinib (mesylate)

Sign In for Pricing
View Details
Flumatinib (mesylate)
HY-13905-04 25 mg

Flumatinib (mesylate)

Sign In for Pricing
View Details
Flumatinib (mesylate)
HY-13905-05 50 mg

Flumatinib (mesylate)

Sign In for Pricing
View Details
Flumatinib (mesylate)
HY-13905-06 100 mg

Flumatinib (mesylate)

Sign In for Pricing
View Details