Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANKRD33 Peptide - C-terminal region

ANKRD33 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C12orf7, DKFZp686O1689

UniProt

Q7Z3H0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ANKRD33 Rabbit Polyclonal Antibody (orb586766) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_872414

Preservative

Lyophilized powder

AA Sequence

WVFVPYQSPQGILSKCLQWLQPRDSTSPRPQVPKILLSKASSSSHQCQPK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MLL (10F8D7) : m-IgG Fc BP-HRP Bundle
sc-539764 1 Kit

MLL (10F8D7) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD45 Antibody[30-F11]
E-AB-F1136UH-01 25 µg

PE/Cyanine7 Anti-Mouse CD45 Antibody[30-F11]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD45 Antibody[30-F11]
E-AB-F1136UH-02 100 µg

PE/Cyanine7 Anti-Mouse CD45 Antibody[30-F11]

Sign In for Pricing
View Details
Rgs1 (NM_019336) Rat Tagged ORF Clone
RR210518 10 µg

Rgs1 (NM_019336) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Streptococcus Pneumoniae SPH_0238 Protein (aa 1-77) (strain Hungary19A-6)
VAng-Ly1461-50gEcoli 50 µg (E. coli)

Recombinant Streptococcus Pneumoniae SPH_0238 Protein (aa 1-77) (strain Hungary19A-6)

Sign In for Pricing
View Details
Pcdh24 3'UTR Luciferase Stable Cell Line
TU215874 1.0 mL

Pcdh24 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details