Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOWAHC Peptide - C-terminal region

SOWAHC Peptide - C-terminal region

Product Specifications

Product Name Alternative

C2orf26, ANKRD57

UniProt

Q53LP3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SOWAHC Rabbit Polyclonal Antibody (orb326652) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_075392

Preservative

Lyophilized powder

AA Sequence

TYKLSHALEDGGDHHHHHHSAEGWVGGKAKDPGRKASGSSSGRIKPRLNK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Prostacyclin ELISA Kit
MBS738923-01 48 Well

Chicken Prostacyclin ELISA Kit

Sign In for Pricing
View Details
Chicken Prostacyclin ELISA Kit
MBS738923-02 96 Well

Chicken Prostacyclin ELISA Kit

Sign In for Pricing
View Details
Chicken Prostacyclin ELISA Kit
MBS738923-03 5x 96 Well

Chicken Prostacyclin ELISA Kit

Sign In for Pricing
View Details
Chicken Prostacyclin ELISA Kit
MBS738923-04 10x 96 Well

Chicken Prostacyclin ELISA Kit

Sign In for Pricing
View Details
KIR2DL3 (p58 KIR, CD158), Human, Recombinant, Recombinant, E.coli
E53A02729 50 µg

KIR2DL3 (p58 KIR, CD158), Human, Recombinant, Recombinant, E.coli

Sign In for Pricing
View Details
Keratocan (h) : 293T Lysate
sc-115212 100 µg - 200 µL

Keratocan (h) : 293T Lysate

Sign In for Pricing
View Details