Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOWAHC Peptide - C-terminal region

SOWAHC Peptide - C-terminal region

Product Specifications

Product Name Alternative

C2orf26, ANKRD57

UniProt

Q53LP3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SOWAHC Rabbit Polyclonal Antibody (orb326652) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_075392

Preservative

Lyophilized powder

AA Sequence

TYKLSHALEDGGDHHHHHHSAEGWVGGKAKDPGRKASGSSSGRIKPRLNK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C7orf16 Rabbit Polyclonal Antibody (APC)
orb996489 100 µL

C7orf16 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Lentiviral mouse Clpb shRNA (UAS) - Lentiviral mouse Clpb shRNA (UAS, iRFP) (25)
GTR15182162 1 Vial

Lentiviral mouse Clpb shRNA (UAS) - Lentiviral mouse Clpb shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
LLGL2 sgRNA CRISPR Lentivector (Human) (Target 2)
K1220103 1.0 µg DNA

LLGL2 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
RAD23A siRNA (Human)
CRH3975-01 15 nmol

RAD23A siRNA (Human)

Sign In for Pricing
View Details
RAD23A siRNA (Human)
CRH3975-02 30 nmol

RAD23A siRNA (Human)

Sign In for Pricing
View Details
Sheep Tachykinin 4 (TAC4) ELISA Kit
MBS9946558-01 48 Well

Sheep Tachykinin 4 (TAC4) ELISA Kit

Sign In for Pricing
View Details