Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOWAHC Peptide - N-terminal region

SOWAHC Peptide - N-terminal region

Product Specifications

Product Name Alternative

C2orf26, ANKRD57

UniProt

Q53LP3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SOWAHC Rabbit Polyclonal Antibody (orb326653) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_075392

Preservative

Lyophilized powder

AA Sequence

PGQGRELGEGEPPAPAHWPPLSAGARRKNSRRDVQPLPRTPAPGPSEDLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ki-67 (Proliferating Cell Marker) (MKI67/2466), CF647 conjugate, 0.1mg/mL
BNC472466-100 1x 100 µL

Ki-67 (Proliferating Cell Marker) (MKI67/2466), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human CDY1B activation kit by CRISPRa
GA116740 1 Kit

Human CDY1B activation kit by CRISPRa

Sign In for Pricing
View Details
FITC Conjugated Pisum sativum Lectin (Garden Pea) -PEAPSA-
F-2701-2 2 mg

FITC Conjugated Pisum sativum Lectin (Garden Pea) -PEAPSA-

Sign In for Pricing
View Details
CLNS1A Rabbit Polyclonal Antibody
AP17217PU-N 400 µL

CLNS1A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
o-Dianisidine
TRC-D416498-250MG 250 mg

o-Dianisidine

Sign In for Pricing
View Details
PPP2R5B (NM_006244) Human Recombinant Protein
TP306889M 100 µg

PPP2R5B (NM_006244) Human Recombinant Protein

Sign In for Pricing
View Details