Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOWAHC Peptide - N-terminal region

SOWAHC Peptide - N-terminal region

Product Specifications

Product Name Alternative

C2orf26, ANKRD57

UniProt

Q53LP3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SOWAHC Rabbit Polyclonal Antibody (orb326653) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_075392

Preservative

Lyophilized powder

AA Sequence

PGQGRELGEGEPPAPAHWPPLSAGARRKNSRRDVQPLPRTPAPGPSEDLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glutathione S Transferase alpha 1 (GSTA1) (NM_145740) Human Recombinant Protein
TP308750 20 µg

Glutathione S Transferase alpha 1 (GSTA1) (NM_145740) Human Recombinant Protein

Sign In for Pricing
View Details
4,4-Difluoro-L-prolinamide Hydrochloride
TRC-D451325-250MG 250 mg

4,4-Difluoro-L-prolinamide Hydrochloride

Sign In for Pricing
View Details
TentaGel® S CHO
S30136.5G 5 g

TentaGel® S CHO

Sign In for Pricing
View Details
FITC Anti-Mouse F4/80 Antibody[CI:A3-1]
E-AB-F0995C-01 50 Tests

FITC Anti-Mouse F4/80 Antibody[CI:A3-1]

Sign In for Pricing
View Details
FITC Anti-Mouse F4/80 Antibody[CI:A3-1]
E-AB-F0995C-02 100 Tests

FITC Anti-Mouse F4/80 Antibody[CI:A3-1]

Sign In for Pricing
View Details
FITC Anti-Mouse F4/80 Antibody[CI:A3-1]
E-AB-F0995C-03 2x 100 Tests

FITC Anti-Mouse F4/80 Antibody[CI:A3-1]

Sign In for Pricing
View Details