Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASB14 Peptide - N-terminal region

ASB14 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp313L0121

UniProt

A6NK59

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ASB14 Rabbit Polyclonal Antibody (orb326658) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_569058

Preservative

Lyophilized powder

AA Sequence

LELLIQAGFDVNFMLDQRINKHYDDHRKSALYFAVSNSDLSSVKLLLSAG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Indoleacetic acid 10mM * 1mL in DMSO
A20953-10mM-D 10 mM x 1mL in DMSO

3-Indoleacetic acid 10mM * 1mL in DMSO

Sign In for Pricing
View Details
NLRP6 Antibody, HRP conjugated
A29759-100UG 100 µg

NLRP6 Antibody, HRP conjugated

Sign In for Pricing
View Details
MRRF2 Antibody
orb807274 2 mg

MRRF2 Antibody

Sign In for Pricing
View Details
Rat Protein Wnt-3a (WNT3A) Protein
abx655514-01 10 µg

Rat Protein Wnt-3a (WNT3A) Protein

Sign In for Pricing
View Details
Rat Protein Wnt-3a (WNT3A) Protein
abx655514-02 50 µg

Rat Protein Wnt-3a (WNT3A) Protein

Sign In for Pricing
View Details
Rat Protein Wnt-3a (WNT3A) Protein
abx655514-03 100 µg

Rat Protein Wnt-3a (WNT3A) Protein

Sign In for Pricing
View Details