Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASB14 Peptide - N-terminal region

ASB14 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp313L0121

UniProt

A6NK59

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ASB14 Rabbit Polyclonal Antibody (orb326658) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_569058

Preservative

Lyophilized powder

AA Sequence

LELLIQAGFDVNFMLDQRINKHYDDHRKSALYFAVSNSDLSSVKLLLSAG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Chloroethyl-2,3,4,6-tetra-O-acetyl-a-D-mannopyranoside
GC0442-2g 2 g

2-Chloroethyl-2,3,4,6-tetra-O-acetyl-a-D-mannopyranoside

Sign In for Pricing
View Details
FLI1 antibody
70R-17319 50 ul

FLI1 antibody

Sign In for Pricing
View Details
Recombinant Human HSPC014 Protein - (Dry Ice)
H00051371-P01-10ug 10 µg

Recombinant Human HSPC014 Protein - (Dry Ice)

Sign In for Pricing
View Details
ARRDC1 (NM_152285) Human Over-expression Lysate
LS092714 100 µg

ARRDC1 (NM_152285) Human Over-expression Lysate

Sign In for Pricing
View Details
DRINKWATER450X52CARD-T1-P16 Pipe Markers for Water
N005851 2 Card (2 Marker (s) x 1 Card)

DRINKWATER450X52CARD-T1-P16 Pipe Markers for Water

Sign In for Pricing
View Details
IL-12 p70
M10-048-L100 100 µg

IL-12 p70

Sign In for Pricing
View Details