Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C16orf53 Peptide - N-terminal region

C16orf53 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ22459, GAS, MGC4606, PA1, C16orf53

UniProt

Q9BTK6

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C16orf53 Rabbit Polyclonal Antibody (orb586773) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078792

Preservative

Lyophilized powder

AA Sequence

GPSASAGKAEDEGEGGREETEREGSGGEEAQGEVPSAGGEEPAEEDSEDW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD46 (122.2), CF405S conjugate, 0.1mg/mL
BNC040175-500 1x 500 µL

CD46 (122.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PU.1 (SPI-1) (B-Cell Marker) (PU1/2146), CF740 conjugate, 0.1mg/mL
BNC742146-500 1x 500 µL

PU.1 (SPI-1) (B-Cell Marker) (PU1/2146), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 7 (Glandular and Transitional Epithelial Marker) (rOV-TL12/30), CF640R conjugate, 0.1mg/mL
BNC401841-100 1x 100 µL

Cytokeratin 7 (Glandular and Transitional Epithelial Marker) (rOV-TL12/30), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Beta-2 Microglobulin (B2M) (BBM.1), CF640R conjugate, 0.1mg/mL
BNC400142-100 1x 100 µL

Beta-2 Microglobulin (B2M) (BBM.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Spectrin beta III (SPTBN2) (SPTBN2/1778), CF568 conjugate, 0.1mg/mL
BNC681778-500 1x 500 µL

Spectrin beta III (SPTBN2) (SPTBN2/1778), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (Nuclear Marker) (r1415-1), CF405S conjugate, 0.1mg/mL
BNC041797-500 1x 500 µL

Histone H1 (Nuclear Marker) (r1415-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details