Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CABP7 Peptide - C-terminal region

CABP7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CALN2, MGC57793

UniProt

Q86V35

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CABP7 Rabbit Polyclonal Antibody (orb586774) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_872333

Preservative

Lyophilized powder

AA Sequence

LYDTFCEHLSMKDIENIIMTEEESHLGTAEECPVDVETCSNQQIRQTCVR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-3127-5p agomir
HY-R00563A-01 5 nmol

Hsa-miR-3127-5p agomir

Sign In for Pricing
View Details
Hsa-miR-3127-5p agomir
HY-R00563A-02 20 nmol

Hsa-miR-3127-5p agomir

Sign In for Pricing
View Details
Human Malate Dehydrogenase 2 (MDH2) ELISA Kit
orb1664888-01 48 Tests

Human Malate Dehydrogenase 2 (MDH2) ELISA Kit

Sign In for Pricing
View Details
Human Malate Dehydrogenase 2 (MDH2) ELISA Kit
orb1664888-02 96 Tests

Human Malate Dehydrogenase 2 (MDH2) ELISA Kit

Sign In for Pricing
View Details
Rabbit Monoclonal SLC16A3 Antibody
NBP3-33421-100ul 100 µL

Rabbit Monoclonal SLC16A3 Antibody

Sign In for Pricing
View Details
Rat IgG (H+L) Antibody : Biotin
OASB02142-1MG 1 mg

Rat IgG (H+L) Antibody : Biotin

Sign In for Pricing
View Details