Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CABP7 Peptide - C-terminal region

CABP7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CALN2, MGC57793

UniProt

Q86V35

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CABP7 Rabbit Polyclonal Antibody (orb586774) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_872333

Preservative

Lyophilized powder

AA Sequence

LYDTFCEHLSMKDIENIIMTEEESHLGTAEECPVDVETCSNQQIRQTCVR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Immunoglobulin G (IgG) ELISA Kit
MBS2088130-01 24 Strip Well

Human Immunoglobulin G (IgG) ELISA Kit

Sign In for Pricing
View Details
Human Immunoglobulin G (IgG) ELISA Kit
MBS2088130-02 48 Well

Human Immunoglobulin G (IgG) ELISA Kit

Sign In for Pricing
View Details
Human Immunoglobulin G (IgG) ELISA Kit
MBS2088130-03 96 Well

Human Immunoglobulin G (IgG) ELISA Kit

Sign In for Pricing
View Details
Human Immunoglobulin G (IgG) ELISA Kit
MBS2088130-04 5x 96 Well

Human Immunoglobulin G (IgG) ELISA Kit

Sign In for Pricing
View Details
Human Immunoglobulin G (IgG) ELISA Kit
MBS2088130-05 10x 96 Well

Human Immunoglobulin G (IgG) ELISA Kit

Sign In for Pricing
View Details
DDX18 293 Cell Lysate
407681 0.1 mg

DDX18 293 Cell Lysate

Sign In for Pricing
View Details