Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC59 Peptide - C-terminal region

CCDC59 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BR22, DKFZp686K1021, FLJ10294, HSPC128, TAP26

UniProt

Q9P031

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC59 Rabbit Polyclonal Antibody (orb326661) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_054886

Preservative

Lyophilized powder

AA Sequence

EPLFEDQCSFDQPQPEEQCIKTVNSFTIPKKNKKKTSNQKAQEEYEQIQA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CA4 Protein, N-His
E55P1384 50 µg

Recombinant Human CA4 Protein, N-His

Sign In for Pricing
View Details
Serine/threonine-protein kinase/endoribonuclease IRE1
orb1641935-01 50 µg

Serine/threonine-protein kinase/endoribonuclease IRE1

Sign In for Pricing
View Details
Serine/threonine-protein kinase/endoribonuclease IRE1
orb1641935-02 100 µg

Serine/threonine-protein kinase/endoribonuclease IRE1

Sign In for Pricing
View Details
Serine/threonine-protein kinase/endoribonuclease IRE1
orb1641935-03 1 mg

Serine/threonine-protein kinase/endoribonuclease IRE1

Sign In for Pricing
View Details
stabilin1 (STAB1) (NM_015136) Human Tagged Lenti ORF Clone
RC215389L1 10 µg

stabilin1 (STAB1) (NM_015136) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Cocksfoot mottle virus Capsid protein (ORF3)
MBS1449639-01 0.02 mg (E-Coli)

Recombinant Cocksfoot mottle virus Capsid protein (ORF3)

Sign In for Pricing
View Details