Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC59 Peptide - C-terminal region

CCDC59 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BR22, DKFZp686K1021, FLJ10294, HSPC128, TAP26

UniProt

Q9P031

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC59 Rabbit Polyclonal Antibody (orb326661) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_054886

Preservative

Lyophilized powder

AA Sequence

EPLFEDQCSFDQPQPEEQCIKTVNSFTIPKKNKKKTSNQKAQEEYEQIQA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ADP/ATP translocase 4 (SLC25A31), partial
MBS7098349 Inquire

Recombinant Human ADP/ATP translocase 4 (SLC25A31), partial

Sign In for Pricing
View Details
HDHD2 Knockout jurkat Polyclonal Cells
ARG34234 1 Million

HDHD2 Knockout jurkat Polyclonal Cells

Sign In for Pricing
View Details
4-Cyanobenzylamine
sc-299498 5 g

4-Cyanobenzylamine

Sign In for Pricing
View Details
1-Palmitoyl-2-Oleoyl-sn-3-Glycerophosphatidylcholine (D31)
MBS393849-01 5 mg

1-Palmitoyl-2-Oleoyl-sn-3-Glycerophosphatidylcholine (D31)

Sign In for Pricing
View Details
1-Palmitoyl-2-Oleoyl-sn-3-Glycerophosphatidylcholine (D31)
MBS393849-02 5x 5 mg

1-Palmitoyl-2-Oleoyl-sn-3-Glycerophosphatidylcholine (D31)

Sign In for Pricing
View Details
Anti-Hu CD71 Purified
MBS1801272-01 0.1 mg

Anti-Hu CD71 Purified

Sign In for Pricing
View Details