CCDC99 Peptide - C-terminal region
CCDC99 Peptide - C-terminal region
Product Specifications
Product Name Alternative
FLJ20364, FLJ40690, CCDC99
UniProt
Q96EA4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CCDC99 Rabbit Polyclonal Antibody (orb586777) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_060255
Preservative
Lyophilized powder
AA Sequence
PRLAAESKLQTEVKEGKETSSKLEKETCKKLHPILYVSSKSTPETQCPQQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740668-100 1x 100 µL
MART-1 / Melan-A (A103), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940859-500 1x 500 µL
Human Kappa Light Chain (Kap-56), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
KN417993 1 Kit
Sphingosine 1 phosphate phosphatase 2 (SGPP2) Human Gene Knockout Kit (CRISPR)
Sign In for Pricing
View Details