Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC99 Peptide - C-terminal region

CCDC99 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ20364, FLJ40690, CCDC99

UniProt

Q96EA4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC99 Rabbit Polyclonal Antibody (orb586777) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060255

Preservative

Lyophilized powder

AA Sequence

PRLAAESKLQTEVKEGKETSSKLEKETCKKLHPILYVSSKSTPETQCPQQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tetramethylrhodamine Methyl Ester, Perchlorate
#70017 1x 25 mg

Tetramethylrhodamine Methyl Ester, Perchlorate

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS705002 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Lhx6 Mouse Monoclonal Antibody [Clone ID: N228A/16]
75-241 100 µL

Lhx6 Mouse Monoclonal Antibody [Clone ID: N228A/16]

Sign In for Pricing
View Details
MIR520d Human qPCR Primer Pair (MI0003164)
HP300428 200 Reactions

MIR520d Human qPCR Primer Pair (MI0003164)

Sign In for Pricing
View Details
Fumarylacetoacetate hydrolase (FAH) Human Gene Knockout Kit (CRISPR)
KN400388 1 Kit

Fumarylacetoacetate hydrolase (FAH) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Girdin (CCDC88A) activation kit by CRISPRa
GA110898 1 Kit

Human Girdin (CCDC88A) activation kit by CRISPRa

Sign In for Pricing
View Details