Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DEPDC1B Peptide - N-terminal region

DEPDC1B Peptide - N-terminal region

Product Specifications

Product Name Alternative

BRCC3, FLJ11252, XTP1

UniProt

Q8WUY9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DEPDC1B Rabbit Polyclonal Antibody (orb586794) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060839

Preservative

Lyophilized powder

AA Sequence

DIKGKWGEEDFEDNRHLYRFPPSSPLKPYPKKPPNQKDVIKFPEWNDLPP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRAPPC4 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2G8]
TA505599BM 100 µL

TRAPPC4 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2G8]

Sign In for Pricing
View Details
Neurofilament (NF-L) (NFL/736), CF647 conjugate, 0.1mg/mL
BNC470736-500 1x 500 µL

Neurofilament (NF-L) (NFL/736), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Mouse TLR3/CD283 Protein (His Tag)
PKSM040834 100 µg

Recombinant Mouse TLR3/CD283 Protein (His Tag)

Sign In for Pricing
View Details
Mouse Fcer2a activation kit by CRISPRa
GA201374 1 Kit

Mouse Fcer2a activation kit by CRISPRa

Sign In for Pricing
View Details
NFIB / NF1B2 Mouse Monoclonal Antibody [1H5]
EM1701-69 100 µL

NFIB / NF1B2 Mouse Monoclonal Antibody [1H5]

Sign In for Pricing
View Details
Zfp273 Mouse Gene Knockout Kit (CRISPR)
KN519765 1 Kit

Zfp273 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details