Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAH12 Peptide - N-terminal region

DNAH12 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DHC3, DLP12, DNAH12L, DNAH7L, DNAHC12, DNAHC3, DNHD2, FLJ40427, FLJ44290, HL-19, HL19, hdhc3

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DNAH12 Rabbit Polyclonal Antibody (orb586795) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_940966

Preservative

Lyophilized powder

AA Sequence

LPENIGVDTPTQSKLLKYRRSKEQQQKINQLVIDGAKRNLDRTLGKRTPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nandrolone 17-Propionate
TRC-N315050-500MG 500 mg

Nandrolone 17-Propionate

Sign In for Pricing
View Details
MIR6716 Human qPCR Primer Pair (MI0022550)
HP301314 200 Reactions

MIR6716 Human qPCR Primer Pair (MI0022550)

Sign In for Pricing
View Details
D-Mannose-6-phosphate Sodium Salt
TRC-M185003-5MG 5 mg

D-Mannose-6-phosphate Sodium Salt

Sign In for Pricing
View Details
Biotin Peroxidase Colloidal Gold,  40nm
GB-02-40 1 mL

Biotin Peroxidase Colloidal Gold, 40nm

Sign In for Pricing
View Details
TACC2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4F10]
TA804145AM 100 µL

TACC2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4F10]

Sign In for Pricing
View Details
Recombinant MAP3K2 Antibody
RC-4644-01 50 μL

Recombinant MAP3K2 Antibody

Sign In for Pricing
View Details