DNAH12 Peptide - N-terminal region
DNAH12 Peptide - N-terminal region
Product Specifications
Product Name Alternative
DHC3, DLP12, DNAH12L, DNAH7L, DNAHC12, DNAHC3, DNHD2, FLJ40427, FLJ44290, HL-19, HL19, hdhc3
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DNAH12 Rabbit Polyclonal Antibody (orb586795) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_940966
Preservative
Lyophilized powder
AA Sequence
LPENIGVDTPTQSKLLKYRRSKEQQQKINQLVIDGAKRNLDRTLGKRTPL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog