Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FUNDC2 Peptide - N-terminal region

FUNDC2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DC44, FLJ33773, HCBP6, HCC3, MGC131676, MGC2495, PD03104

UniProt

Q9BWH2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FUNDC2 Rabbit Polyclonal Antibody (orb586804) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_076423

Preservative

Lyophilized powder

AA Sequence

RADPLRVSSRDKLTEMAASSQGNFEGNFESLDLAEFAKKQPWWRKLFGQE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Deiodinase (DI) Elisa Kit
EK730187 96 Well

Mouse Deiodinase (DI) Elisa Kit

Sign In for Pricing
View Details
Fcho1 (NM_028715) Mouse Tagged ORF Clone Lentiviral Particle
MR211026L3V 200 µL

Fcho1 (NM_028715) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CLASP2 (CLIP-associating Protein 2, Cytoplasmic Linker-associated Protein 2, Protein Orbit Homolog 2, hOrbit2, KIAA0627) discontinued
C5831-03E 100 µg

CLASP2 (CLIP-associating Protein 2, Cytoplasmic Linker-associated Protein 2, Protein Orbit Homolog 2, hOrbit2, KIAA0627) discontinued

Sign In for Pricing
View Details
RRAGD Antibody
DF9812-01 100 µL

RRAGD Antibody

Sign In for Pricing
View Details
RRAGD Antibody
DF9812-02 200 µL

RRAGD Antibody

Sign In for Pricing
View Details
Phospholipase C beta 4 (PLCB4) (NM_001172646) Human Tagged Lenti ORF Clone
RC230671L4 10 µg

Phospholipase C beta 4 (PLCB4) (NM_001172646) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details