Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FUNDC2 Peptide - N-terminal region

FUNDC2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DC44, FLJ33773, HCBP6, HCC3, MGC131676, MGC2495, PD03104

UniProt

Q9BWH2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FUNDC2 Rabbit Polyclonal Antibody (orb586804) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_076423

Preservative

Lyophilized powder

AA Sequence

RADPLRVSSRDKLTEMAASSQGNFEGNFESLDLAEFAKKQPWWRKLFGQE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human HSPA9/Mortalin/GRP75 Protein, N-GST & C-His
YHE23202 100 μg

Recombinant Human HSPA9/Mortalin/GRP75 Protein, N-GST & C-His

Sign In for Pricing
View Details
Rat soluble Interleukin 6 Receptor (sIL-6R) ELISA Kit
EIA05885r 1 Kit

Rat soluble Interleukin 6 Receptor (sIL-6R) ELISA Kit

Sign In for Pricing
View Details
hsa-miR-3926 miRNA Inhibitor
MIH02140 2x 5.0 nmol

hsa-miR-3926 miRNA Inhibitor

Sign In for Pricing
View Details
gamma-Secretase modulator 4
MBS5766704 Inquire

gamma-Secretase modulator 4

Sign In for Pricing
View Details
Rabbit anti-Zea mays (Maize) GS1-5 Polyclonal Antibody
MBS7157401 Inquire

Rabbit anti-Zea mays (Maize) GS1-5 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Purple sea urchin Integrin B1A Antibody, Dylight550 Conjugate
DZ41543-Dylight550 200 µL

Anti-Purple sea urchin Integrin B1A Antibody, Dylight550 Conjugate

Sign In for Pricing
View Details