Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR45 Peptide - N-terminal region

GPR45 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PSP24, PSP24 (ALPHA), PSP24A

UniProt

Q9Y5Y3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR45 Rabbit Polyclonal Antibody (orb586809) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009158

Preservative

Lyophilized powder

AA Sequence

LNTSNASDSGSTQLPAPLRISLAIVMLLMTVVGFLGNTVVCIIVYQRPAM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse IL-17A Recombinant Rabbit Monoclonal Antibody [PS01-92] - BSA and Azide free (Detector)
HA721607 100 µL

Mouse IL-17A Recombinant Rabbit Monoclonal Antibody [PS01-92] - BSA and Azide free (Detector)

Sign In for Pricing
View Details
Cdc27 Mouse Gene Knockout Kit (CRISPR)
KN502968 1 Kit

Cdc27 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RAB11FIP4 Mouse Monoclonal Antibody [Clone ID: OTI13B5]
CF808377 100 µg

RAB11FIP4 Mouse Monoclonal Antibody [Clone ID: OTI13B5]

Sign In for Pricing
View Details
RanGAP1 Antibody
KC-2009-01 50 μL

RanGAP1 Antibody

Sign In for Pricing
View Details
RanGAP1 Antibody
KC-2009-02 100 µL

RanGAP1 Antibody

Sign In for Pricing
View Details
RanGAP1 Antibody
KC-2009-03 1 mL

RanGAP1 Antibody

Sign In for Pricing
View Details