Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR45 Peptide - N-terminal region

GPR45 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PSP24, PSP24 (ALPHA), PSP24A

UniProt

Q9Y5Y3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR45 Rabbit Polyclonal Antibody (orb586809) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009158

Preservative

Lyophilized powder

AA Sequence

LNTSNASDSGSTQLPAPLRISLAIVMLLMTVVGFLGNTVVCIIVYQRPAM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acetyl CoA synthetase (ACSS2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3G3]
TA503608BM 100 µL

Acetyl CoA synthetase (ACSS2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3G3]

Sign In for Pricing
View Details
Human TXNL1 activation kit by CRISPRa
GA106235 1 Kit

Human TXNL1 activation kit by CRISPRa

Sign In for Pricing
View Details
Protein C inhibitor (SERPINA5) Rabbit Polyclonal Antibody
AP01414PU-N 100 µg

Protein C inhibitor (SERPINA5) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NEDD9 Polyclonal Antibody
E-AB-90321-01 60 µL

NEDD9 Polyclonal Antibody

Sign In for Pricing
View Details
NEDD9 Polyclonal Antibody
E-AB-90321-02 120 µL

NEDD9 Polyclonal Antibody

Sign In for Pricing
View Details
NEDD9 Polyclonal Antibody
E-AB-90321-03 200 µL

NEDD9 Polyclonal Antibody

Sign In for Pricing
View Details