Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADGRF4 Peptide - N-terminal region

ADGRF4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PGR18, GPR115

UniProt

Q8IZF3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADGRF4 Rabbit Polyclonal Antibody (orb586812) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_722580

Preservative

Lyophilized powder

AA Sequence

SQATMICCLVFFLSTECSHYRSKIHLKAGDKLQSPEGKPKTGRIQEKCEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-STING1/TMEM173 Polyclonal Antibody
HV094014-01 50 µg

Anti-STING1/TMEM173 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-STING1/TMEM173 Polyclonal Antibody
HV094014-02 100 µg

Anti-STING1/TMEM173 Polyclonal Antibody

Sign In for Pricing
View Details
Dog IgM / PE
orb1610991 100 µL

Dog IgM / PE

Sign In for Pricing
View Details
Human GABRB1 shRNA Plasmid
abx951698-01 150 µg

Human GABRB1 shRNA Plasmid

Sign In for Pricing
View Details
Human GABRB1 shRNA Plasmid
abx951698-02 300 µg

Human GABRB1 shRNA Plasmid

Sign In for Pricing
View Details
8-Diazomethyl quinoline
HY-180518 1 Each

8-Diazomethyl quinoline

Sign In for Pricing
View Details