Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADGRF4 Peptide - N-terminal region

ADGRF4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PGR18, GPR115

UniProt

Q8IZF3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADGRF4 Rabbit Polyclonal Antibody (orb586812) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_722580

Preservative

Lyophilized powder

AA Sequence

SQATMICCLVFFLSTECSHYRSKIHLKAGDKLQSPEGKPKTGRIQEKCEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Sphingosine 1 phosphate phosphatase 2 Antibody
NBP3-11906-25ug 25 µg

Rabbit Polyclonal Sphingosine 1 phosphate phosphatase 2 Antibody

Sign In for Pricing
View Details
STAB2 ORF Vector (Human) (pORF)
ORF033471 1.0 µg DNA

STAB2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Rabbit Polyclonal GCAP1 Antibody [DyLight 350]
NBP3-00054UV 0.1 mL

Rabbit Polyclonal GCAP1 Antibody [DyLight 350]

Sign In for Pricing
View Details
pOTB7-NUDT1-2 Plasmid
PVT26665 2 µg

pOTB7-NUDT1-2 Plasmid

Sign In for Pricing
View Details
Prolactin (PRL, Prl) (MaxLight 650)
MBS6494630-01 0.1 mL

Prolactin (PRL, Prl) (MaxLight 650)

Sign In for Pricing
View Details
Prolactin (PRL, Prl) (MaxLight 650)
MBS6494630-02 5x 0.1 mL

Prolactin (PRL, Prl) (MaxLight 650)

Sign In for Pricing
View Details