Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

H2AFV Peptide - N-terminal region

H2AFV Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ26479, H2AV, MGC10170, MGC10831, MGC1947

UniProt

A6NKY0

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with H2AFV Rabbit Polyclonal Antibody (orb326670) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036544

Preservative

Lyophilized powder

AA Sequence

MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGAT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARHGEF1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV666117 1.0 µg DNA

ARHGEF1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
TSLC1 Rabbit Polyclonal Antibody (Cy5.5)
orb1042485 100 µL

TSLC1 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
RPA1 Monoclonal Antibody
CSB-MA593248 100 µL

RPA1 Monoclonal Antibody

Sign In for Pricing
View Details
Anti-SLC22A1 Antibody Picoband® Fluoro488 Conjugated
PA2172-Fluoro488 100 µg/Vial

Anti-SLC22A1 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Small heat shock protein hspG3 (hspG3)
MBS1288140-01 0.02 mg (E-Coli)

Recombinant Dictyostelium discoideum Small heat shock protein hspG3 (hspG3)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Small heat shock protein hspG3 (hspG3)
MBS1288140-02 0.1 mg (E-Coli)

Recombinant Dictyostelium discoideum Small heat shock protein hspG3 (hspG3)

Sign In for Pricing
View Details