Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

H2AFV Peptide - N-terminal region

H2AFV Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ26479, H2AV, MGC10170, MGC10831, MGC1947

UniProt

A6NKY0

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with H2AFV Rabbit Polyclonal Antibody (orb326670) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036544

Preservative

Lyophilized powder

AA Sequence

MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGAT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF652 siRNA (Mouse)
MBS8213927-01 15 nmol

ZNF652 siRNA (Mouse)

Sign In for Pricing
View Details
ZNF652 siRNA (Mouse)
MBS8213927-02 30 nmol

ZNF652 siRNA (Mouse)

Sign In for Pricing
View Details
ZNF652 siRNA (Mouse)
MBS8213927-03 5x 30 nmol

ZNF652 siRNA (Mouse)

Sign In for Pricing
View Details
Anti-ELP4 Polyclonal Antibody
TMAB-05548-01 50 μL

Anti-ELP4 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-ELP4 Polyclonal Antibody
TMAB-05548-02 100 µL

Anti-ELP4 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-ELP4 Polyclonal Antibody
TMAB-05548-03 200 µL

Anti-ELP4 Polyclonal Antibody

Sign In for Pricing
View Details