Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HHIPL2 Peptide - C-terminal region

HHIPL2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ13840, KIAA1822L

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HHIPL2 Rabbit Polyclonal Antibody (orb586817) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079022

Preservative

Lyophilized powder

AA Sequence

PGKCKYKPVPVRTKSKRIPFRPLAKTVLDLLKEQSEKAARKSSSATLASG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse TPO/Thpo protein (His tag)
PDEM100272-01 20 µg

Recombinant Mouse TPO/Thpo protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse TPO/Thpo protein (His tag)
PDEM100272-02 100 µg

Recombinant Mouse TPO/Thpo protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse TPO/Thpo protein (His tag)
PDEM100272-03 500 µg

Recombinant Mouse TPO/Thpo protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse TPO/Thpo protein (His tag)
PDEM100272-04 1 mg

Recombinant Mouse TPO/Thpo protein (His tag)

Sign In for Pricing
View Details
3-Bromoacetylpyridine, Hydrobromide
TRC-B679110-5G 5 g

3-Bromoacetylpyridine, Hydrobromide

Sign In for Pricing
View Details
Diacetyl Bis(2,4-dinitrophenylhydrazone)
TRC-D422530-250MG 250 mg

Diacetyl Bis(2,4-dinitrophenylhydrazone)

Sign In for Pricing
View Details