Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPA14 Peptide - N-terminal region

HSPA14 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HSP70-4, HSP70L1, MGC131990

UniProt

Q0VDF9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HSPA14 Rabbit Polyclonal Antibody (orb586819) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057383

Preservative

Lyophilized powder

AA Sequence

AVVAYSENEEIVGLAAKQSRIRNISNTVMKVKQILGRSSSDPQAQKYIAE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MLL5 (Mixed Lineage Leukemia 5, NKp44L, HDCMC04P) (FITC)
MBS6426829-01 0.1 mL

MLL5 (Mixed Lineage Leukemia 5, NKp44L, HDCMC04P) (FITC)

Sign In for Pricing
View Details
MLL5 (Mixed Lineage Leukemia 5, NKp44L, HDCMC04P) (FITC)
MBS6426829-02 5x 0.1 mL

MLL5 (Mixed Lineage Leukemia 5, NKp44L, HDCMC04P) (FITC)

Sign In for Pricing
View Details
NIT2 shRNA (h) Lentiviral Particles
sc-78047-V 200 µL

NIT2 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
plakophilin 3 Lentiviral Activation Particles (h2)
sc-403614-LAC-2 200 µL

plakophilin 3 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
DPF3 antibody - middle region (ARP34293_P050)
ARP34293_P050 100 µL

DPF3 antibody - middle region (ARP34293_P050)

Sign In for Pricing
View Details
RPL17P14 sgRNA CRISPR Lentivector set (Human)
K1913701 3x 1.0 µg

RPL17P14 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details