Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FASTKD3 Peptide - N-terminal region

FASTKD3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ23274, MGC142123, MGC5297

UniProt

Q14CZ7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FASTKD3 Rabbit Polyclonal Antibody (orb586826) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_076996

Preservative

Lyophilized powder

AA Sequence

HPLGGPVFSQVSDCDRLEQNVKNEESQMFYRRLSNLTSSEEVLSFISTME

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant NPHP1 Antibody
RN-14670-01 50 μL

Recombinant NPHP1 Antibody

Sign In for Pricing
View Details
Recombinant NPHP1 Antibody
RN-14670-02 100 µL

Recombinant NPHP1 Antibody

Sign In for Pricing
View Details
Recombinant NPHP1 Antibody
RN-14670-03 1 mL

Recombinant NPHP1 Antibody

Sign In for Pricing
View Details
Sirt6 Rabbit Polyclonal Antibody
TA381514 100 µL

Sirt6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human VWA3B activation kit by CRISPRa
GA116348 1 Kit

Human VWA3B activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Il4ra activation kit by CRISPRa
GA202146 1 Kit

Mouse Il4ra activation kit by CRISPRa

Sign In for Pricing
View Details