FASTKD3 Peptide - N-terminal region
FASTKD3 Peptide - N-terminal region
Product Specifications
Product Name Alternative
FLJ23274, MGC142123, MGC5297
UniProt
Q14CZ7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FASTKD3 Rabbit Polyclonal Antibody (orb586826) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_076996
Preservative
Lyophilized powder
AA Sequence
HPLGGPVFSQVSDCDRLEQNVKNEESQMFYRRLSNLTSSEEVLSFISTME
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AP14960PU-N 400 µL
G protein alpha 12 (GNA12) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
![CD21 Recombinant Rabbit Monoclonal Antibody [PD00-23]](https://cdn.genprice.uk/products/992/68dd1c8b061270361ea815e2/imageurl/ha721163.webp)
HA721163 100 µL
CD21 Recombinant Rabbit Monoclonal Antibody [PD00-23]
Sign In for Pricing
View Details ![Elab Fluor® 647 Anti-Mouse CD150/SLAM Antibody[TC15-12F12.2]](https://cdn.genprice.uk/products/763/68dd14af061270361e7d36be/imageurl/e-ab-f1177m.webp)
E-AB-F1177M-01 50 Tests
Elab Fluor® 647 Anti-Mouse CD150/SLAM Antibody[TC15-12F12.2]
Sign In for Pricing
View Details E-AB-F1177M-02 100 Tests
Elab Fluor® 647 Anti-Mouse CD150/SLAM Antibody[TC15-12F12.2]
Sign In for Pricing
View Details E-AB-F1177M-03 2x 100 Tests
Elab Fluor® 647 Anti-Mouse CD150/SLAM Antibody[TC15-12F12.2]
Sign In for Pricing
View Details