FBXO17 Peptide - N-terminal region
FBXO17 Peptide - N-terminal region
Product Specifications
Product Name Alternative
FBG4, FBX26, FBXO26, FLJ11798, FLJ25205, FLJ58300, Fbx17, MGC9379
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FBXO17 Rabbit Polyclonal Antibody (orb326672) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_680474
Preservative
Lyophilized powder
AA Sequence
VQVLSHVPPRSLVTRCRPVCRAWRDIVDGPTVWLLQLARDRSAEGRALYA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog