FBXO17 Peptide - N-terminal region
FBXO17 Peptide - N-terminal region
Product Specifications
Product Name Alternative
FBG4, FBX26, FBXO26, FLJ11798, FLJ25205, FLJ58300, Fbx17, MGC9379
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FBXO17 Rabbit Polyclonal Antibody (orb326672) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_680474
Preservative
Lyophilized powder
AA Sequence
VQVLSHVPPRSLVTRCRPVCRAWRDIVDGPTVWLLQLARDRSAEGRALYA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC041744-100 1x 100 µL
Epstein-Barr Virus (LMP-1) (CS4), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
![TRIM9 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G10]](https://cdn.genprice.uk/products/937/6868c385994c49e6dc3f921c/imageurl/ta800045bm.webp)
TA800045BM 100 µL
TRIM9 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G10]
Sign In for Pricing
View Details 
LY426860 100 µg
alpha 1 Antitrypsin (SERPINA1) (NM_001127702) Human Over-expression Lysate
Sign In for Pricing
View Details 
TRC-D493766-250MG 250 mg
2-(Di-tert-butylphosphino)-1,1'-binaphthyl 98% TrixiePhos
Sign In for Pricing
View Details 
BNC941123-500 1x 500 µL
TOX3 (TOX3/1123), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details